Reaction Details |
| Report a problem with these data |
Target | D(4) dopamine receptor |
---|
Ligand | BDBM50200029 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_422467 (CHEMBL910419) |
---|
EC50 | 5±n/a nM |
---|
Citation | Patel, MV; Kolasa, T; Mortell, K; Matulenko, MA; Hakeem, AA; Rohde, JJ; Nelson, SL; Cowart, MD; Nakane, M; Miller, LN; Uchic, ME; Terranova, MA; El-Kouhen, OF; Donnelly-Roberts, DL; Namovic, MT; Hollingsworth, PR; Chang, R; Martino, BR; Wetter, JM; Marsh, KC; Martin, R; Darbyshire, JF; Gintant, G; Hsieh, GC; Moreland, RB; Sullivan, JP; Brioni, JD; Stewart, AO Discovery of 3-methyl-N-(1-oxy-3',4',5',6'-tetrahydro-2'H-[2,4'-bipyridine]-1'-ylmethyl)benzamide (ABT-670), an orally bioavailable dopamine D4 agonist for the treatment of erectile dysfunction. J Med Chem49:7450-65 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
D(4) dopamine receptor |
---|
Name: | D(4) dopamine receptor |
Synonyms: | D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | DRD4_HUMAN | Dopamine D4 receptor |
Type: | Enzyme |
Mol. Mass.: | 48373.19 |
Organism: | Homo sapiens (Human) |
Description: | P21917 |
Residue: | 419 |
Sequence: | MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
|
|
|
BDBM50200029 |
---|
n/a |
---|
Name | BDBM50200029 |
Synonyms: | 6-(4-((1H-benzo[d]imidazol-2-yl)methyl)piperazin-1-yl)pyridin-3-ol | A-425444 | CHEMBL219179 |
Type | Small organic molecule |
Emp. Form. | C17H19N5O |
Mol. Mass. | 309.3657 |
SMILES | Oc1ccc(nc1)N1CCN(Cc2nc3ccccc3[nH]2)CC1 |
Structure |
|