Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1B
LigandBDBM50213737
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447503
IC50>3200±n/a nM
Citation Wang YBusch-Petersen JWang FMa LFu WKerns JKJin JPalovich MRShen JKBurman MFoley JJSchmidt DBHunsberger GESarau HMWiddowson KL 3-Arylamino-2H-1,2,4-benzothiadiazin-5-ol 1,1-dioxides as novel and selective CXCR2 antagonists. Bioorg Med Chem Lett 17:3864-7 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1B
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | S12 | Serotonin 1D beta receptor | Serotonin Receptor 1B
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:43579.17
Organism:Homo sapiens (Human)
Description:Receptor binding assays were performed using human clone stably expressed in CHO cells
Residue:390
Sequence:
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50213737
n/a
NameBDBM50213737
Synonyms:7-nitro-1,1-dioxo-3-(2-phenoxy-phenylamino)-1,4-dihydro-1lambda6-benzo[1,2,4]thiadiazin-5-ol | CHEMBL399203
TypeSmall organic molecule
Emp. Form.C19H14N4O6S
Mol. Mass.426.403
SMILESOc1cc(cc2c1N=C(Nc1ccccc1Oc1ccccc1)NS2(=O)=O)[N+]([O-])=O |t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: