| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM50219035 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_445299 (CHEMBL894439) |
|---|
| IC50 | 34±n/a nM |
|---|
| Citation |  Jiang, Y; Chen, CA; Lu, K; Daniewska, I; De Leon, J; Kong, R; Forray, C; Li, B; Hegde, LG; Wolinsky, TD; Craig, DA; Wetzel, JM; Andersen, K; Marzabadi, MR Synthesis and SAR investigations for novel melanin-concentrating hormone 1 receptor (MCH1) antagonists Part 1. The discovery of arylacetamides as viable replacements for the dihydropyrimidinone moiety of an HTS hit. J Med Chem50:3870-82 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 24 | Gpr24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCH1R | MCHR | MCHR-1 | MCHR1_RAT | Mchr1 | Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 | SLC-1 | Slc1 | Somatostatin receptor-like protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39075.64 |
|---|
| Organism: | RAT |
|---|
| Description: | Melanin Concentrating Hormone 1 GPR24 RAT::P97639 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
|
|
|
|---|
| BDBM50219035 |
|---|
| n/a |
|---|
| Name | BDBM50219035 |
|---|
| Synonyms: | CHEMBL243355 | N-{5-[1-(3-{[bis(4-fluorophenyl)acetyl]amino}propyl)-4-piperidinyl]-2,4-difluorophenyl}-2-methylpropanamide | SNAP-102739 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H35F4N3O2 |
|---|
| Mol. Mass. | 569.6328 |
|---|
| SMILES | CC(C)C(=O)Nc1cc(C2CCN(CCCNC(=O)C(c3ccc(F)cc3)c3ccc(F)cc3)CC2)c(F)cc1F |
|---|
| Structure | 
|
|---|
Search and Browse
