Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50219931 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_449062 (CHEMBL898267) |
---|
Ki | >5000±n/a nM |
---|
Citation | Takeuchi, K; Holloway, WG; McKinzie, JH; Suter, TM; Statnick, MA; Surface, PL; Emmerson, PJ; Thomas, EM; Siegel, MG; Matt, JE; Wolfe, CN; Mitch, CH Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett17:5349-52 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50219931 |
---|
n/a |
---|
Name | BDBM50219931 |
Synonyms: | 6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinonitrile | CHEMBL236393 |
Type | Small organic molecule |
Emp. Form. | C21H19N3O |
Mol. Mass. | 329.3951 |
SMILES | N#Cc1ccc(Oc2ccc(CCNCc3ccccc3)cc2)nc1 |
Structure |
|