Reaction Details |
| Report a problem with these data |
Target | Sphingosine 1-phosphate receptor 4 |
---|
Ligand | BDBM50249154 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_499715 (CHEMBL980650) |
---|
IC50 | 6.15±n/a nM |
---|
Citation | Evindar, G; Satz, AL; Bernier, SG; Kavarana, MJ; Doyle, E; Lorusso, J; Taghizadeh, N; Halley, K; Hutchings, A; Kelley, MS; Wright, AD; Saha, AK; Hannig, G; Morgan, BA; Westlin, WF Synthesis and evaluation of arylalkoxy- and biarylalkoxy-phenylamide and phenylimidazoles as potent and selective sphingosine-1-phosphate receptor subtype-1 agonists. Bioorg Med Chem Lett19:2315-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sphingosine 1-phosphate receptor 4 |
---|
Name: | Sphingosine 1-phosphate receptor 4 |
Synonyms: | EDG6 | Endothelial differentiation G-protein coupled receptor 6 | S1P receptor 4 | S1P receptor Edg-6 | S1P4 | S1PR4 | S1PR4_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-6 | Sphingosine-1-phosphate receptor 4 | sphingosine-1-phosphate 4 S1P4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 41647.39 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 384 |
Sequence: | MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
|
|
|
BDBM50249154 |
---|
n/a |
---|
Name | BDBM50249154 |
Synonyms: | (S)-2-amino-3-(4-(biphenyl-4-ylmethoxy)phenylamino)-2-methyl-3-oxopropyl dihydrogen phosphate | CHEMBL473563 |
Type | Small organic molecule |
Emp. Form. | C23H25N2O6P |
Mol. Mass. | 456.4282 |
SMILES | C[C@](N)(COP(O)(O)=O)C(=O)Nc1ccc(OCc2ccc(cc2)-c2ccccc2)cc1 |r| |
Structure |
|