new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50282321
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34944
Ki 32±n/a nM
Citation Lloyd JRyono DEBird JEBuote JDelaney CLDejneka TDickinson KEMoreland SNormandin DESkwish SSpitzmiller ERWaldron TL Quinoline-4-carboxylic acids as angiotensin II receptor antagonists Bioorg Med Chem Lett 4:195-200 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50282321
n/a
NameBDBM50282321
Synonyms:7-Chloro-2-cyclopropyl-3-[2'-(2H-tetrazol-5-yl)-biphenyl-4-yloxy]-quinoline-4-carboxylic acid | CHEMBL64567
TypeSmall organic molecule
Emp. Form.C26H18ClN5O3
Mol. Mass.483.906
SMILESOC(=O)c1c(Oc2ccc(cc2)-c2ccccc2-c2nnn[nH]2)c(nc2cc(Cl)ccc12)C1CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: