Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50283723 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_79815 |
---|
IC50 | 0.050000±n/a nM |
---|
Citation | Dorsey, BD; McDaniel, SL; Levin, RB; Vacca, JP; Darke, PL; Zuga, JA; Emini, EA; Schleif, WA; Lin, JH; Chen, IW; Holloway, MK; Anderson, PS; Huff, JR Synthesis and evaluation of pyridyl analogs of L-735,524: Potent HIV-1 protease inhibitors Bioorg Med Chem Lett4:2769-2774 (1994) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50283723 |
---|
n/a |
---|
Name | BDBM50283723 |
Synonyms: | (S)-1-[(2S,4R)-2-Hydroxy-4-((1S,2R)-2-hydroxy-indan-1-ylcarbamoyl)-5-pyridin-4-yl-pentyl]-4-thieno[3,2-b]thiophen-2-ylmethyl-piperazine-2-carboxylic acid tert-butylamide | CHEMBL96697 |
Type | Small organic molecule |
Emp. Form. | C36H45N5O4S2 |
Mol. Mass. | 675.904 |
SMILES | CC(C)(C)NC(=O)[C@@H]1CN(Cc2cc3sccc3s2)CCN1C[C@@H](O)C[C@@H](Cc1ccncc1)C(=O)N[C@@H]1[C@H](O)Cc2ccccc12 |
Structure |
|