| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50285274 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79813 |
|---|
| IC50 | 1.2±n/a nM |
|---|
| Citation |  Kim, BM; Hanifin, CM; Zartman, CB; Vacca, JP; Michelson, SR; Lin, JH; Chen, IW; Vastag, K; Darke, PL; Zugay, JA; Emini, EA; Schleif, W; Anderson, PS; Huff, JR Substituted alkylpyridines as P3′ ligands for the hydroxyethylpiperazine class of HIV-1 protease inhibitors: Improved pharmacokinetic profiles Bioorg Med Chem Lett5:2239-2244 (1995) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50285274 |
|---|
| n/a |
|---|
| Name | BDBM50285274 |
|---|
| Synonyms: | CHEMBL307966 | {(1S,2R)-1-Benzyl-3-[(S)-2-tert-butylcarbamoyl-4-(2-sec-butyl-pyridin-4-ylmethyl)-piperazin-1-yl]-2-hydroxy-propyl}-carbamic acid (2R,3R)-2-isopropyl-1,1-dioxo-tetrahydro-1lambda*6*-thiophen-3-yl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C37H57N5O6S |
|---|
| Mol. Mass. | 699.943 |
|---|
| SMILES | CCC(C)c1cc(CN2CCN(C[C@@H](O)[C@H](Cc3ccccc3)NC(=O)O[C@@H]3CCS(=O)(=O)[C@@H]3C(C)C)[C@@H](C2)C(=O)NC(C)(C)C)ccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
