Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50285453 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_79467 |
---|
IC50 | 0.180000±n/a nM |
---|
Citation | Kim, BM; Guare, JP; Vacca, JD; Michelson, SR; Darke, PL; Zugay, JA; Emini, EA; Schleif, W; Lin, JH; Chen, IW; Vastag, K; Anderson, PS; Huff, JR Thiophene derivatives as extremely high affinity P3′ ligands for the hydroxyethylpiperazine class of HIV-1 protease inhibitors Bioorg Med Chem Lett5:185-190 (1995) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50285453 |
---|
n/a |
---|
Name | BDBM50285453 |
Synonyms: | CHEMBL292193 | {(1S,2R)-1-Benzyl-3-[(S)-4-(4-bromo-thiophen-2-ylmethyl)-2-tert-butylcarbamoyl-piperazin-1-yl]-2-hydroxy-propyl}-carbamic acid (2R,3R)-2-isopropyl-1,1-dioxo-tetrahydro-1lambda*6*-thiophen-3-yl ester |
Type | Small organic molecule |
Emp. Form. | C32H47BrN4O6S2 |
Mol. Mass. | 727.773 |
SMILES | CC(C)[C@@H]1[C@@H](CCS1(=O)=O)OC(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN1CCN(Cc2cc(Br)cs2)C[C@H]1C(=O)NC(C)(C)C |
Structure |
|