Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Ligand | BDBM50288763 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_195891 |
---|
Ki | 1200±n/a nM |
---|
Citation | Babine, RE; Bleckman, TM; Littlefield, ES; Parge, HE; Pelletier, LA; Lewis, CT; French, JV; Imbacuan, M; Katoh, S; Tatlock, JH; Showalter, RE; Villafranca, JE Design, synthesis and X-ray crystallographic studies of [7.3.1] and [8.3.1] macrocyclic FKBP-12 ligands Bioorg Med Chem Lett6:385-390 (1996) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase FKBP1A |
---|
Name: | Peptidyl-prolyl cis-trans isomerase FKBP1A |
Synonyms: | 12 kDa FK506-binding protein | 12 kDa FKBP | FK506-binding protein 1A | FK506-binding protein 1A (FKBP12) | FKB1A_HUMAN | FKBP-12 | FKBP-1A | FKBP1 | FKBP12 | FKBP1A | Immunophilin FKBP12 | PPIase | PPIase FKBP1A | Peptidyl-prolyl cis-trans isomerase (FKBP) | Rotamase | RyR1/FKBP12 | mTOR/FKBP12A/FKBP12B |
Type: | Isomerase |
Mol. Mass.: | 11953.09 |
Organism: | Homo sapiens (Human) |
Description: | P62942 |
Residue: | 108 |
Sequence: | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
|
|
|
BDBM50288763 |
---|
n/a |
---|
Name | BDBM50288763 |
Synonyms: | (1S,9R)-5-Benzyloxymethyl-13-[2-oxo-2-(3,4,5-trimethoxy-phenyl)-acetyl]-3,7-dioxa-13-aza-bicyclo[7.3.1]tridecane-2,8-dione | CHEMBL276123 |
Type | Small organic molecule |
Emp. Form. | C29H33NO10 |
Mol. Mass. | 555.573 |
SMILES | COc1cc(cc(OC)c1OC)C(=O)C(=O)N1[C@@H]2CCC[C@H]1C(=O)OCC(COCc1ccccc1)COC2=O |
Structure |
|