new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetComplement C1r
LigandBDBM50288999
Substrate/Competitorn/a
Meas. Tech.ChEMBL_40172
IC50>62500±n/a nM
Citation Gilmore JLHays SJCaprathe BWLee CEmmerling MRMichael WJaen JC Synthesis and evaluation of 2-aryl-4H-3,1-benzoxazin-4-ones as C1r serine protease inhibitors Bioorg Med Chem Lett 6:679-682 (1996)    Article
More Info.:Get all data from this article,  Assay Method
 
Complement C1r
Name:Complement C1r
Synonyms:Complement C1r
Type:Enzyme
Mol. Mass.:80113.65
Organism:Homo sapiens (Human)
Description:P00736
Residue:705
Sequence:
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50288999
n/a
NameBDBM50288999
Synonyms:2-(2-Iodo-phenyl)-7-methyl-benzo[d][1,3]oxazin-4-one | CHEMBL345362
TypeSmall organic molecule
Emp. Form.C15H10INO2
Mol. Mass.363.1499
SMILESCc1ccc2c(c1)nc(oc2=O)-c1ccccc1I
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: