Reaction Details |
| Report a problem with these data |
Target | Prostaglandin D2 receptor 2 |
---|
Ligand | BDBM50296978 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_580959 (CHEMBL1054924) |
---|
IC50 | 744±n/a nM |
---|
Citation | Stearns, BA; Baccei, C; Bain, G; Broadhead, A; Clark, RC; Coate, H; Evans, JF; Fagan, P; Hutchinson, JH; King, C; Lee, C; Lorrain, DS; Prasit, P; Prodanovich, P; Santini, A; Scott, JM; Stock, NS; Truong, YP Novel tricyclic antagonists of the prostaglandin D2 receptor DP2 with efficacy in a murine model of allergic rhinitis. Bioorg Med Chem Lett19:4647-51 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor 2 |
---|
Name: | Prostaglandin D2 receptor 2 |
Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
Type: | Enzyme |
Mol. Mass.: | 43295.45 |
Organism: | Homo sapiens (Human) |
Description: | Q9Y5Y4 |
Residue: | 395 |
Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
BDBM50296978 |
---|
n/a |
---|
Name | BDBM50296978 |
Synonyms: | 2-(4,6-bis(dimethylamino)-2-(4-(4-(trifluoromethyl)benzamido)benzyl)pyrimidin-5-yl)acetic acid | CHEMBL551813 |
Type | Small organic molecule |
Emp. Form. | C25H26F3N5O3 |
Mol. Mass. | 501.5008 |
SMILES | CN(C)c1nc(Cc2ccc(NC(=O)c3ccc(cc3)C(F)(F)F)cc2)nc(N(C)C)c1CC(O)=O |
Structure |
|