| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50296979 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_580961 (CHEMBL1054926) |
|---|
| IC50 | 2200±n/a nM |
|---|
| Citation |  Stearns, BA; Baccei, C; Bain, G; Broadhead, A; Clark, RC; Coate, H; Evans, JF; Fagan, P; Hutchinson, JH; King, C; Lee, C; Lorrain, DS; Prasit, P; Prodanovich, P; Santini, A; Scott, JM; Stock, NS; Truong, YP Novel tricyclic antagonists of the prostaglandin D2 receptor DP2 with efficacy in a murine model of allergic rhinitis. Bioorg Med Chem Lett19:4647-51 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50296979 |
|---|
| n/a |
|---|
| Name | BDBM50296979 |
|---|
| Synonyms: | 2-((3R)-3-(4-fluoro-N-methylphenylsulfonamido)-3,4-dihydro-1H-carbazol-9(2H,4bH,8aH)-yl)acetic acid | CHEMBL563664 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H23FN2O4S |
|---|
| Mol. Mass. | 418.482 |
|---|
| SMILES | CN([C@@H]1CCC2=C(C1)C1C=CC=CC1N2CC(O)=O)S(=O)(=O)c1ccc(F)cc1 |r,c:5,10,12| |
|---|
| Structure | 
|
|---|
Search and Browse
