Reaction Details |
| Report a problem with these data |
Target | C-X-C chemokine receptor type 1 |
---|
Ligand | BDBM50200887 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_584048 (CHEMBL1055928) |
---|
Ki | 210±n/a nM |
---|
Citation | Aki, C; Chao, J; Ferreira, JA; Dwyer, MP; Yu, Y; Chao, J; Merritt, RJ; Lai, G; Wu, M; Hipkin, RW; Fan, X; Gonsiorek, W; Fosseta, J; Rindgen, D; Fine, J; Lundell, D; Taveras, AG; Biju, P Diaminocyclobutenediones as potent and orally bioavailable CXCR2 receptor antagonists: SAR in the phenolic amide region. Bioorg Med Chem Lett19:4446-9 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 1 |
---|
Name: | C-X-C chemokine receptor type 1 |
Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
Type: | Enzyme |
Mol. Mass.: | 39803.83 |
Organism: | Homo sapiens (Human) |
Description: | P25024 |
Residue: | 350 |
Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
BDBM50200887 |
---|
n/a |
---|
Name | BDBM50200887 |
Synonyms: | (R)-3-(3,4-dioxo-2-(1-(thiophen-2-yl)propylamino)cyclobut-1-enylamino)-2-hydroxy-N,N-dimethylbenzamide | CHEMBL385715 |
Type | Small organic molecule |
Emp. Form. | C20H21N3O4S |
Mol. Mass. | 399.463 |
SMILES | CC[C@@H](Nc1c(Nc2cccc(C(=O)N(C)C)c2O)c(=O)c1=O)c1cccs1 |r| |
Structure |
|