| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hematopoietic prostaglandin D synthase |
|---|
| Ligand | BDBM50300129 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_593692 (CHEMBL1044145) |
|---|
| IC50 | 2E2±n/a nM |
|---|
| Citation |  Weber, JE; Oakley, AJ; Christ, AN; Clark, AG; Hayes, JD; Hall, R; Hume, DA; Board, PG; Smythe, ML; Flanagan, JU Identification and characterisation of new inhibitors for the human hematopoietic prostaglandin D2 synthase. Eur J Med Chem45:447-54 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hematopoietic prostaglandin D synthase |
|---|
| Name: | Hematopoietic prostaglandin D synthase |
|---|
| Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 23341.07 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
|---|
| Residue: | 199 |
|---|
| Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
|---|
| BDBM50300129 |
|---|
| n/a |
|---|
| Name | BDBM50300129 |
|---|
| Synonyms: | CHEMBL572528 | CIBACRON BLUE | Cibacron Blue 3Ga |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H20ClN7O11S3 |
|---|
| Mol. Mass. | 774.157 |
|---|
| SMILES | Nc1c(cc(Nc2ccc(Nc3nc(Cl)nc(Nc4ccccc4S(O)(=O)=O)n3)c(c2)S(O)(=O)=O)c2C(=O)c3ccccc3C(=O)c12)S(O)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
