Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50312467
Substrate/Competitorn/a
Meas. Tech.ChEMBL_620648
EC50 11±n/a nM
Citation Epple RCow CXie YAzimioara MRusso RWang XWityak JKaranewsky DSTuntland TNguyêñ-Trân VTCuc Ngo CHuang DSaez ESpalding TGerken AIskandar MSeidel HMTian SS Novel bisaryl substituted thiazoles and oxazoles as highly potent and selective peroxisome proliferator-activated receptor delta agonists. J Med Chem 53:77-105 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor
Synonyms:NR1C2 | NUC1 | NUCI | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR delta | PPAR-beta | PPARB | PPARD | Peroxisome proliferator-activated receptor beta
Type:Enzyme
Mol. Mass.:49910.45
Organism:Homo sapiens (Human)
Description:Q03181
Residue:441
Sequence:
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312467
n/a
NameBDBM50312467
Synonyms:2-(4-((5-(4-(Trifluoromethyl)phenyl)-4-(4-isopropoxyphenyl)-thiazol-2-yl)methoxy)-2-methylphenoxy)acetic Acid | CHEMBL1081546
TypeSmall organic molecule
Emp. Form.C29H26F3NO5S
Mol. Mass.557.581
SMILESCC(C)Oc1ccc(cc1)-c1nc(COc2ccc(OCC(O)=O)c(C)c2)sc1-c1ccc(cc1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: