| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50312933 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_616045 (CHEMBL1102008) |
|---|
| IC50 | 250±n/a nM |
|---|
| Citation |  Zeng, Q; Allen, JG; Bourbeau, MP; Wang, X; Yao, G; Tadesse, S; Rider, JT; Yuan, CC; Hong, FT; Lee, MR; Zhang, S; Lofgren, JA; Freeman, DJ; Yang, S; Li, C; Tominey, E; Huang, X; Hoffman, D; Yamane, HK; Fotsch, C; Dominguez, C; Hungate, R; Zhang, X Azole-based inhibitors of AKT/PKB for the treatment of cancer. Bioorg Med Chem Lett20:1559-64 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50312933 |
|---|
| n/a |
|---|
| Name | BDBM50312933 |
|---|
| Synonyms: | (S)-5-(2-(2-amino-3-(4-(trifluoromethyl)phenyl)propylamino)thiazol-5-yl)indolin-2-one | CHEMBL1081831 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H19F3N4OS |
|---|
| Mol. Mass. | 432.462 |
|---|
| SMILES | N[C@H](CNc1ncc(s1)-c1ccc2NC(=O)Cc2c1)Cc1ccc(cc1)C(F)(F)F |r| |
|---|
| Structure | 
|
|---|
Search and Browse
