Reaction Details |
| Report a problem with these data |
Target | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Ligand | BDBM50314708 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_625853 (CHEMBL1109789) |
---|
IC50 | >50000±n/a nM |
---|
Citation | Dong, L; Marakovits, J; Hou, X; Guo, C; Greasley, S; Dagostino, E; Ferre, R; Johnson, MC; Kraynov, E; Thomson, J; Pathak, V; Murray, BW Structure-based design of novel human Pin1 inhibitors (II). Bioorg Med Chem Lett20:2210-4 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
---|
Name: | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Synonyms: | PIN1 | PIN1_HUMAN | PPIase Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
Type: | PROTEIN |
Mol. Mass.: | 18248.11 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1502595 |
Residue: | 163 |
Sequence: | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
|
|
|
BDBM50314708 |
---|
n/a |
---|
Name | BDBM50314708 |
Synonyms: | (R)-2-(2-naphthamido)-5-cyclohexenylpent-4-enoic acid | CHEMBL1091060 |
Type | Small organic molecule |
Emp. Form. | C22H23NO3 |
Mol. Mass. | 349.4229 |
SMILES | OC(=O)[C@@H](C\C=C\C1=CCCCC1)NC(=O)c1ccc2ccccc2c1 |r,t:7| |
Structure |
|