Reaction Details |
| Report a problem with these data |
Target | Aldo-keto reductase family 1 member B10 |
---|
Ligand | BDBM16314 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_640033 (CHEMBL1174247) |
---|
IC50 | 54±n/a nM |
---|
Citation | Endo, S; Matsunaga, T; Kuwata, K; Zhao, HT; El-Kabbani, O; Kitade, Y; Hara, A Chromene-3-carboxamide derivatives discovered from virtual screening as potent inhibitors of the tumour maker, AKR1B10. Bioorg Med Chem18:2485-90 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Aldo-keto reductase family 1 member B10 |
---|
Name: | Aldo-keto reductase family 1 member B10 |
Synonyms: | AK1BA_HUMAN | AKR1B10 | AKR1B11 | ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldo-keto reductase family member 1B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP |
Type: | Protein |
Mol. Mass.: | 36024.67 |
Organism: | Homo sapiens (Human) |
Description: | O60218. 1ZUA; 4JII; 4GQ0 |
Residue: | 316 |
Sequence: | MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
|
|
|
BDBM16314 |
---|
n/a |
---|
Name | BDBM16314 |
Synonyms: | 2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat |
Type | Small organic molecule |
Emp. Form. | C16H14F3NO3S |
Mol. Mass. | 357.347 |
SMILES | COc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O |
Structure |
|