| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50279080 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_655048 (CHEMBL1244092) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Hilberg, F; Roth, GJ; Krssak, M; Kautschitsch, S; Sommergruber, W; Tontsch-Grunt, U; Garin-Chesa, P; Bader, G; Zoephel, A; Quant, J; Heckel, A; Rettig, WJ BIBF 1120: triple angiokinase inhibitor with sustained receptor blockade and good antitumor efficacy. Cancer Res68:4774-82 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50279080 |
|---|
| n/a |
|---|
| Name | BDBM50279080 |
|---|
| Synonyms: | (Z)-3-[(4-{Methyl-[2-(4-methylpiperazin-1-yl)acetyl]amino}-phenylamino)-methylene]-2-oxo-2,3-dihydro-1H-indole-6-carboxylicAcid Methyl Ester | CHEMBL502835 | methyl (3Z)-3-{[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}phenyl)amino](phenyl)methylidene}-2-oxo-2,3-dihydro-1H-indole-6-carboxylate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C31H33N5O4 |
|---|
| Mol. Mass. | 539.6248 |
|---|
| SMILES | COC(=O)c1ccc2C(C(=Nc3ccc(cc3)N(C)C(=O)CN3CCN(C)CC3)c3ccccc3)C(=O)Nc2c1 |w:10.10| |
|---|
| Structure | 
|
|---|
Search and Browse
