Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50318666 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_658577 (CHEMBL1247910) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Rottmann, M; McNamara, C; Yeung, BK; Lee, MC; Zou, B; Russell, B; Seitz, P; Plouffe, DM; Dharia, NV; Tan, J; Cohen, SB; Spencer, KR; González-Páez, GE; Lakshminarayana, SB; Goh, A; Suwanarusk, R; Jegla, T; Schmitt, EK; Beck, HP; Brun, R; Nosten, F; Renia, L; Dartois, V; Keller, TH; Fidock, DA; Winzeler, EA; Diagana, TT Spiroindolones, a potent compound class for the treatment of malaria. Science329:1175-80 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50318666 |
---|
n/a |
---|
Name | BDBM50318666 |
Synonyms: | (1R,3S)-5',7-Dichloro-6-fluoro-3-methyl-2,3,4,9-tetrahydrospiro-[beta-carboline-1,3'-indol]-2'(1'H)-one | CHEMBL1082723 | NITD609 |
Type | Small organic molecule |
Emp. Form. | C19H14Cl2FN3O |
Mol. Mass. | 390.238 |
SMILES | C[C@H]1Cc2c([nH]c3cc(Cl)c(F)cc23)[C@@]2(N1)C(=O)Nc1ccc(Cl)cc21 |r| |
Structure |
|