Reaction Details |
| Report a problem with these data |
Target | G-protein coupled bile acid receptor 1 |
---|
Ligand | BDBM50327542 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_664648 (CHEMBL1260362) |
---|
IC50 | >10000±n/a nM |
---|
Citation | Herbert, MR; Siegel, DL; Staszewski, L; Cayanan, C; Banerjee, U; Dhamija, S; Anderson, J; Fan, A; Wang, L; Rix, P; Shiau, AK; Rao, TS; Noble, SA; Heyman, RA; Bischoff, E; Guha, M; Kabakibi, A; Pinkerton, AB Synthesis and SAR of 2-aryl-3-aminomethylquinolines as agonists of the bile acid receptor TGR5. Bioorg Med Chem Lett20:5718-21 (2010) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
G-protein coupled bile acid receptor 1 |
---|
Name: | G-protein coupled bile acid receptor 1 |
Synonyms: | BG37 | GPBAR1 | GPBAR_HUMAN | M-BAR | TGR5 | hBG37 | hGPCR19 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 35260.02 |
Organism: | Homo sapiens (Human) |
Description: | CHO cells transiently transfected with hTGR5. |
Residue: | 330 |
Sequence: | MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
|
|
|
BDBM50327542 |
---|
n/a |
---|
Name | BDBM50327542 |
Synonyms: | 2-(4-bromophenyl)-N-((6,7-dimethoxy-2-(thiophen-3-yl)quinolin-3-yl)methyl)ethanamine | CHEMBL1257733 |
Type | Small organic molecule |
Emp. Form. | C24H23BrN2O2S |
Mol. Mass. | 483.421 |
SMILES | COc1cc2cc(CNCCc3ccc(Br)cc3)c(nc2cc1OC)-c1ccsc1 |
Structure |
|