| Reaction Details |
|---|
 | Report a problem with these data |
| Target | G-protein coupled bile acid receptor 1 |
|---|
| Ligand | BDBM50327520 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_664649 (CHEMBL1260363) |
|---|
| IC50 | 4300±n/a nM |
|---|
| Citation |  Herbert, MR; Siegel, DL; Staszewski, L; Cayanan, C; Banerjee, U; Dhamija, S; Anderson, J; Fan, A; Wang, L; Rix, P; Shiau, AK; Rao, TS; Noble, SA; Heyman, RA; Bischoff, E; Guha, M; Kabakibi, A; Pinkerton, AB Synthesis and SAR of 2-aryl-3-aminomethylquinolines as agonists of the bile acid receptor TGR5. Bioorg Med Chem Lett20:5718-21 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| G-protein coupled bile acid receptor 1 |
|---|
| Name: | G-protein coupled bile acid receptor 1 |
|---|
| Synonyms: | GPBAR_MOUSE | Gpbar1 | M-BAR | Membrane-type receptor for bile acids | Tgr5 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 35665.78 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_1475560 |
|---|
| Residue: | 329 |
|---|
| Sequence: | MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLRSPPAGCFFLSLLLAG
LLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLLVHGERYMAVLQPLRPH
GSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAPYLYLEVYGLLLPAVGAT
ALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQARAQAGATLLFLLCWGPYV
ATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGLGDQRYTAPWRTAAQRCLRV
LRGRAKRDNPGPSTAYHTSSQCSIDLDLN
|
|
|
|---|
| BDBM50327520 |
|---|
| n/a |
|---|
| Name | BDBM50327520 |
|---|
| Synonyms: | CHEMBL1258310 | N-(4-chlorobenzyl)-1-(7-methoxy-2-(thiophen-3-yl)quinolin-3-yl)methanamine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H19ClN2OS |
|---|
| Mol. Mass. | 394.917 |
|---|
| SMILES | COc1ccc2cc(CNCc3ccc(Cl)cc3)c(nc2c1)-c1ccsc1 |
|---|
| Structure | 
|
|---|
Search and Browse
