Reaction Details |
| Report a problem with these data |
Target | Oxa40 |
---|
Ligand | BDBM50347183 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_754356 (CHEMBL1799222) |
---|
IC50 | 26000±n/a nM |
---|
Citation | Tan, Q; Ogawa, AM; Raghoobar, SL; Wisniewski, D; Colwell, L; Park, YW; Young, K; Hermes, JD; Dininno, FP; Hammond, ML Thiophenyl oxime-derived phosphonates as nano-molar class C beta-lactamase inhibitors reducing MIC of imipenem against Pseudomonas aeruginosa and Acinetobacter baumannii. Bioorg Med Chem Lett21:4363-5 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Oxa40 |
---|
Name: | Oxa40 |
Synonyms: | Beta-lactamase | Class D β-lactamase (OXA-24) |
Type: | Enzyme |
Mol. Mass.: | 30946.50 |
Organism: | Acinetobacter baumannii |
Description: | Q8RLA6 |
Residue: | 275 |
Sequence: | MKKFILPIFSISILVSLSACSSIKTKSEDNFHISSQQHEKAIKSYFDEAQTQGVIIIKEG
KNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMT
LGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEV
NFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQAN
GKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
|
|
|
BDBM50347183 |
---|
n/a |
---|
Name | BDBM50347183 |
Synonyms: | CHEMBL1795566 |
Type | Small organic molecule |
Emp. Form. | C15H13FN3O5PS |
Mol. Mass. | 397.318 |
SMILES | CO\N=C(/C(=O)NCP(O)(=O)Oc1ccc(C#N)c(F)c1)c1cccs1 |
Structure |
|