Reaction Details |
| Report a problem with these data |
Target | Arachidonate 5-lipoxygenase-activating protein |
---|
Ligand | BDBM50359080 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_789492 (CHEMBL1924519) |
---|
IC50 | 239±n/a nM |
---|
Citation | Stock, NS; Bain, G; Zunic, J; Li, Y; Ziff, J; Roppe, J; Santini, A; Darlington, J; Prodanovich, P; King, CD; Baccei, C; Lee, C; Rong, H; Chapman, C; Broadhead, A; Lorrain, D; Correa, L; Hutchinson, JH; Evans, JF; Prasit, P 5-Lipoxygenase-activating protein (FLAP) inhibitors. Part 4: development of 3-[3-tert-butylsulfanyl-1-[4-(6-ethoxypyridin-3-yl)benzyl]-5-(5-methylpyridin-2-ylmethoxy)-1H-indol-2-yl]-2,2-dimethylpropionic acid (AM803), a potent, oral, once daily FLAP inhibitor. J Med Chem54:8013-29 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Arachidonate 5-lipoxygenase-activating protein |
---|
Name: | Arachidonate 5-lipoxygenase-activating protein |
Synonyms: | AL5AP_RAT | Alox5ap | Flap | MK-886-binding protein |
Type: | PROTEIN |
Mol. Mass.: | 18072.95 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_789493 |
Residue: | 161 |
Sequence: | MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNC
VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP
|
|
|
BDBM50359080 |
---|
n/a |
---|
Name | BDBM50359080 |
Synonyms: | CHEMBL1922660 |
Type | Small organic molecule |
Emp. Form. | C38H43N3O4S |
Mol. Mass. | 637.831 |
SMILES | CCOc1ccc(cn1)-c1ccc(Cn2c(CC(C)(C)C(O)=O)c(SC(C)(C)C)c3cc(OCc4ccc(C)cn4)ccc23)cc1 |
Structure |
|