| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 2 |
|---|
| Ligand | BDBM50360700 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_795932 (CHEMBL1936805) |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Chen, X; Mihalic, J; Fan, P; Liang, L; Lindstrom, M; Wong, S; Ye, Q; Fu, Y; Jaen, J; Chen, JL; Dai, K; Li, L Discovery and characterization of a potent and selective antagonist of melanin-concentrating hormone receptor 2. Bioorg Med Chem Lett22:363-6 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 2 |
|---|
| Name: | Melanin-concentrating hormone receptor 2 |
|---|
| Synonyms: | GPR145 | MCHR2 | MCHR2_HUMAN | Melanin Concentrating Hormone 2 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 2 | SLT |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 38862.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Melanin Concentrating Hormone 2 GPR145 HUMAN::Q969V1 |
|---|
| Residue: | 340 |
|---|
| Sequence: | MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
|
|
|
|---|
| BDBM50360700 |
|---|
| n/a |
|---|
| Name | BDBM50360700 |
|---|
| Synonyms: | CHEMBL1934119 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H33N3O2 |
|---|
| Mol. Mass. | 467.6019 |
|---|
| SMILES | CCn1c2ccccc2c2cc(CN3CCC4(CC3)[C@H](O)[C@@H](NC(C)=O)c3ccccc43)ccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
