Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50281637 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_157566 |
---|
Ki | 61±n/a nM |
---|
Citation | Sawyer, T; Fisher, J; Hester, J; Smith, C; Tomasselli, A; Tarpley, W; Burton, P; Hui, J; McQuade, T; Conradi, R; Bradford, V; Liu, L; Kinner, J; Tustin, J; Alexander, D; Harrison, A; Emmert, D; Staples, D; Maggiora, L; Zhang, Y; Poorman, R; Dunna, B; Rao, C; Scarborough, P; Lowther, W; Craik, C; DeCamp, D; Moon, J; Howe, W; Heinrikson, R Peptidomimetic inhibitors of human immunodeficiency virus protease (HIV-PR): Design, enzyme binding and selectivity, antiviral efficacy, and cell permeability properties Bioorg Med Chem Lett3:819-824 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50281637 |
---|
n/a |
---|
Name | BDBM50281637 |
Synonyms: | (2S,4S,5S)-6-Cyclohexyl-4-hydroxy-2-isopropyl-5-{(S)-3-methyl-2-[2-(naphthalen-1-yloxy)-acetylamino]-butyrylamino}-hexanoic acid {(S)-2-methyl-1-[(pyridin-2-ylmethyl)-carbamoyl]-butyl}-amide | CHEMBL167442 |
Type | Small organic molecule |
Emp. Form. | C44H63N5O6 |
Mol. Mass. | 758.0009 |
SMILES | CCC(C)[C@H](NC(=O)[C@@H](C[C@H](O)[C@H](CC1CCCCC1)NC(=O)[C@@H](NC(=O)COc1cccc2ccccc12)C(C)C)C(C)C)C(=O)NCc1ccccn1 |
Structure |
|