| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50281643 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157566 |
|---|
| Ki | 16±n/a nM |
|---|
| Citation |  Sawyer, T; Fisher, J; Hester, J; Smith, C; Tomasselli, A; Tarpley, W; Burton, P; Hui, J; McQuade, T; Conradi, R; Bradford, V; Liu, L; Kinner, J; Tustin, J; Alexander, D; Harrison, A; Emmert, D; Staples, D; Maggiora, L; Zhang, Y; Poorman, R; Dunna, B; Rao, C; Scarborough, P; Lowther, W; Craik, C; DeCamp, D; Moon, J; Howe, W; Heinrikson, R Peptidomimetic inhibitors of human immunodeficiency virus protease (HIV-PR): Design, enzyme binding and selectivity, antiviral efficacy, and cell permeability properties Bioorg Med Chem Lett3:819-824 (1993) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50281643 |
|---|
| n/a |
|---|
| Name | BDBM50281643 |
|---|
| Synonyms: | (2S,4S,5S)-5-Acetylamino-6-cyclohexyl-4-hydroxy-2-isopropyl-hexanoic acid {(1S,2S)-2-methyl-1-[(1-oxy-pyridin-2-ylmethyl)-carbamoyl]-butyl}-amide | CHEMBL166052 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H48N4O5 |
|---|
| Mol. Mass. | 532.7152 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](C[C@H](O)[C@H](CC1CCCCC1)NC(C)=O)C(C)C)C(=O)NCc1cccc[n+]1[O-] |
|---|
| Structure | 
|
|---|
Search and Browse
