Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50281636 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_45171 |
---|
Ki | 2±n/a nM |
---|
Citation | Sawyer, T; Fisher, J; Hester, J; Smith, C; Tomasselli, A; Tarpley, W; Burton, P; Hui, J; McQuade, T; Conradi, R; Bradford, V; Liu, L; Kinner, J; Tustin, J; Alexander, D; Harrison, A; Emmert, D; Staples, D; Maggiora, L; Zhang, Y; Poorman, R; Dunna, B; Rao, C; Scarborough, P; Lowther, W; Craik, C; DeCamp, D; Moon, J; Howe, W; Heinrikson, R Peptidomimetic inhibitors of human immunodeficiency virus protease (HIV-PR): Design, enzyme binding and selectivity, antiviral efficacy, and cell permeability properties Bioorg Med Chem Lett3:819-824 (1993) Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50281636 |
---|
n/a |
---|
Name | BDBM50281636 |
Synonyms: | (S)-N*1*-((1S,2S,4S)-1-Cyclohexylmethyl-2-hydroxy-5-methyl-4-{(S)-2-methyl-1-[(pyridin-2-ylmethyl)-carbamoyl]-butylcarbamoyl}-hexyl)-2-[(quinoline-2-carbonyl)-amino]-succinamide | CHEMBL167514 |
Type | Small organic molecule |
Emp. Form. | C41H57N7O6 |
Mol. Mass. | 743.9346 |
SMILES | CCC(C)[C@H](NC(=O)[C@@H](C[C@H](O)[C@H](CC1CCCCC1)NC(=O)[C@H](CC(N)=O)NC(=O)c1ccc2ccccc2n1)C(C)C)C(=O)NCc1ccccn1 |
Structure |
|