| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50288203 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_157564 |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  Abbenante, G; Bergman, D; Brinkworth, R; March, D; Reid, R; Hunt, P; James, I; Dancer, R; Garnham, B; Stoermer, M; Fairlie, D Structure-activity relationships for macrocyclic peptidomimetic inhibitors of HIV-1 protease Bioorg Med Chem Lett6:2531-2536 (1996) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50288203 |
|---|
| n/a |
|---|
| Name | BDBM50288203 |
|---|
| Synonyms: | 1-{3-[2-(2-Acetylamino-4-methyl-pentanoylamino)-1-carbamoyl-2-oxo-ethylamino]-2-hydroxy-4-phenyl-butyl}-pyrrolidine-2-carboxylic acid [1-(1-carbamoyl-2-methyl-propylcarbamoyl)-2-methyl-butyl]-amide | CHEMBL315957 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H62N8O8 |
|---|
| Mol. Mass. | 758.9477 |
|---|
| SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C[C@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(C)=O)C(=O)N[C@@H](C(C)C)C(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
