Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Ligand | BDBM50101143 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_749 (CHEMBL884527) |
---|
IC50 | 9.80±n/a nM |
---|
Citation | Lesuisse, D; Gourvest, JF; Albert, E; Doucet, B; Hartmann, C; Lefrançois, JM; Tessier, S; Tric, B; Teutsch, G Biphenyls as surrogates of the steroidal backbone. Part 2: discovery of a novel family of non-steroidal 5-alpha-reductase inhibitors. Bioorg Med Chem Lett11:1713-6 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
Type: | Enzyme |
Mol. Mass.: | 28406.59 |
Organism: | Homo sapiens (Human) |
Description: | P31213 |
Residue: | 254 |
Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
BDBM50101143 |
---|
n/a |
---|
Name | BDBM50101143 |
Synonyms: | 4'-[(Diisopropylcarbamoyl)-methoxy]-5'-fluoro-3'-nitro-biphenyl-4-carboxylic acid | CHEMBL50113 |
Type | Small organic molecule |
Emp. Form. | C21H23FN2O6 |
Mol. Mass. | 418.4155 |
SMILES | CC(C)N(C(C)C)C(=O)COc1c(F)cc(cc1[N+]([O-])=O)-c1ccc(cc1)C(O)=O |
Structure |
|