| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Ligand | BDBM50101145 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_749 (CHEMBL884527) |
|---|
| IC50 | 41±n/a nM |
|---|
| Citation |  Lesuisse, D; Gourvest, JF; Albert, E; Doucet, B; Hartmann, C; Lefrançois, JM; Tessier, S; Tric, B; Teutsch, G Biphenyls as surrogates of the steroidal backbone. Part 2: discovery of a novel family of non-steroidal 5-alpha-reductase inhibitors. Bioorg Med Chem Lett11:1713-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 2 | 5 alpha-SR2 | 5α-Reductase 2 (5α-R2) | S5A2_HUMAN | SR type 2 | SRD5A2 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 2 | Type II 5-alpha reductase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28406.59 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P31213 |
|---|
| Residue: | 254 |
|---|
| Sequence: | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
|
|
|
|---|
| BDBM50101145 |
|---|
| n/a |
|---|
| Name | BDBM50101145 |
|---|
| Synonyms: | (4aR,6aS,7S,11aR)-4a,6a-Dimethyl-2-oxo-hexadecahydro-indeno[5,4-f]quinoline-7-carboxylic acid diisopropylamide | CHEMBL297697 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H42N2O2 |
|---|
| Mol. Mass. | 402.6132 |
|---|
| SMILES | CC(C)N(C(C)C)C(=O)[C@H]1CCC2C3CC[C@H]4NC(=O)CC[C@]4(C)C3CC[C@]12C |
|---|
| Structure | 
|
|---|
Search and Browse
