Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50066997 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_63638 |
---|
IC50 | 0.047000±n/a nM |
---|
Citation | Macdonald, SJ; Dowle, MD; Harrison, LA; Spooner, JE; Shah, P; Johnson, MR; Inglis, GG; Clarke, GD; Belton, DJ; Smith, RA; Molloy, CR; Dixon, M; Murkitt, G; Godward, RE; Skarzynski, T; Singh, OM; Kumar, KA; Hodgson, ST; McDonald, E; Hardy, GW; Finch, H; Humphreys, DC; Fleetwood, G Intracellular inhibition of human neutrophil elastase by orally active pyrrolidine-trans-lactams. Bioorg Med Chem Lett11:243-6 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50066997 |
---|
n/a |
---|
Name | BDBM50066997 |
Synonyms: | (3aS,6R)-6-Allyl-4-methanesulfonyl-5-oxo-hexahydro-pyrrolo[3,2-b]pyrrole-1-carboxylic acid benzyl ester | CHEMBL2367632 | benzyl (3aS,6aR)-6-allyl-4-(methylsulfonyl)-5-oxohexahydropyrrolo[3,2-b]pyrrole-1(2H)-carboxylate |
Type | Small organic molecule |
Emp. Form. | C18H22N2O5S |
Mol. Mass. | 378.443 |
SMILES | [H][C@]12CCN(C(=O)OCc3ccccc3)[C@]1([H])[C@@H](CC=C)C(=O)N2S(C)(=O)=O |
Structure |
|