| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutrophil elastase |
|---|
| Ligand | BDBM50096484 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_63638 |
|---|
| IC50 | 0.036000±n/a nM |
|---|
| Citation |  Macdonald, SJ; Dowle, MD; Harrison, LA; Spooner, JE; Shah, P; Johnson, MR; Inglis, GG; Clarke, GD; Belton, DJ; Smith, RA; Molloy, CR; Dixon, M; Murkitt, G; Godward, RE; Skarzynski, T; Singh, OM; Kumar, KA; Hodgson, ST; McDonald, E; Hardy, GW; Finch, H; Humphreys, DC; Fleetwood, G Intracellular inhibition of human neutrophil elastase by orally active pyrrolidine-trans-lactams. Bioorg Med Chem Lett11:243-6 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Neutrophil elastase |
|---|
| Name: | Neutrophil elastase |
|---|
| Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 28532.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P08246 |
|---|
| Residue: | 267 |
|---|
| Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
|---|
| BDBM50096484 |
|---|
| n/a |
|---|
| Name | BDBM50096484 |
|---|
| Synonyms: | (4S,6R)-6-Allyl-4-(naphthalene-2-sulfonyl)-5-oxo-hexahydro-pyrrolo[3,2-b]pyrrole-1-carboxylic acid benzyl ester | CHEMBL2367667 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H26N2O5S |
|---|
| Mol. Mass. | 490.571 |
|---|
| SMILES | [H][C@]12CCN(C(=O)OCc3ccccc3)[C@]1([H])[C@@H](CC=C)C(=O)N2S(=O)(=O)c1ccc2ccccc2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
