| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50123279 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145141 |
|---|
| Ki | 4.2±n/a nM |
|---|
| Citation |  Ananthan, S; Kezar, HS; Saini, SK; Khare, NK; Davis, P; Dersch, CM; Porreca, F; Rothman, RB Synthesis, opioid receptor binding, and functional activity of 5'-substituted 17-cyclopropylmethylpyrido[2',3':6,7]morphinans. Bioorg Med Chem Lett13:529-32 (2003) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50123279 |
|---|
| n/a |
|---|
| Name | BDBM50123279 |
|---|
| Synonyms: | 19-cyclopropylmethyl-6-(1H-1-pyrrolyl)-11-oxa-8,19-diazahexacyclo[10.9.1.01,10.02,18.04,9.016,22]docosa-4(9),5,7,12,14,16(22)-hexaene-2,13-diol | CHEMBL346165 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27N3O3 |
|---|
| Mol. Mass. | 441.5216 |
|---|
| SMILES | Oc1ccc2C[C@H]3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)c1ncc(cc1C[C@@]35O)-n1cccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
