| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM21130 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145459 |
|---|
| Ki | 52±n/a nM |
|---|
| Citation |  Clark, CR; Halfpenny, PR; Hill, RG; Horwell, DC; Hughes, J; Jarvis, TC; Rees, DC; Schofield, D Highly selective kappa opioid analgesics. Synthesis and structure-activity relationships of novel N-[(2-aminocyclohexyl)aryl]acetamide and N-[(2-aminocyclohexyl)aryloxy]acetamide derivatives. J Med Chem31:831-6 (1988) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM21130 |
|---|
| n/a |
|---|
| Name | BDBM21130 |
|---|
| Synonyms: | N-methyl-2-phenyl-N-[(5R,7S,8S)-7-(pyrrolidin-1-yl)-1-oxaspiro[4.5]decan-8-yl]acetamide | N-methyl-N-(7-(1-pyrrolidinyl)-1-oxaspiro(4,5)dec-8-yl)benzeneacetamide | U-69593 | U69,593 | [3H]U69593 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C22H32N2O2 |
|---|
| Mol. Mass. | 356.5017 |
|---|
| SMILES | CN([C@H]1CC[C@@]2(CCCO2)C[C@@H]1N1CCCC1)C(=O)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
