| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50014154 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_201408 |
|---|
| Ki | >1000±n/a nM |
|---|
| Citation |  Rosen, T; Nagel, AA; Rizzi, JP; Ives, JL; Daffeh, JB; Ganong, AH; Guarino, K; Heym, J; McLean, S; Nowakowski, JT Thiazole as a carbonyl bioisostere. A novel class of highly potent and selective 5-HT3 receptor antagonists. J Med Chem33:2715-20 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50014154 |
|---|
| n/a |
|---|
| Name | BDBM50014154 |
|---|
| Synonyms: | 2-(5-Methyl-1H-imidazol-4-ylmethyl)-4-phenyl-thiazole | CHEMBL38465 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H13N3S |
|---|
| Mol. Mass. | 255.338 |
|---|
| SMILES | Cc1nc[nH]c1Cc1nc(cs1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
