Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEDNRA
LigandBDBM50068716
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63369
Ki 16±n/a nM
Citation Murugesan NGu ZStein PDBisaha SSpergel SGirotra RLee VGLloyd JMisra RNSchmidt JMathur AStratton LKelly YFBird EWaldron TLiu ECZhang RLee HSerafino RAbboa-Offei BMathers PGiancarli MSeymour AAWebb MLHunt JT Biphenylsulfonamide endothelin antagonists: structure-activity relationships of a series of mono- and disubstituted analogues and pharmacology of the orally active endothelin antagonist 2'-amino-N- (3,4-dimethyl-5-isoxazolyl)-4'-(2-methylpropyl)[1, 1'-biphenyl]-2-sulfonamide (BMS-187308). J Med Chem 41:5198-218 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
EDNRA
Name:Endothelin receptor
Synonyms:ENDOTHELIN A | Endothelin receptor | Endothelin-1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:48256.91
Organism:RAT
Description:ENDOTHELIN A EDNRA RAT::P26684
Residue:426
Sequence:
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFNFLGTTLQPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50068716
n/a
NameBDBM50068716
Synonyms:2'-Amino-biphenyl-2-sulfonic acid (3,4-dimethyl-isoxazol-5-yl)-amide | CHEMBL347958
TypeSmall organic molecule
Emp. Form.C17H17N3O3S
Mol. Mass.343.4
SMILESCc1noc(NS(=O)(=O)c2ccccc2-c2ccccc2N)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: