Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAminopeptidase A
LigandBDBM50083384
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32830
Ki 20±n/a nM
Citation David CBischoff LMeudal HMothé ADe Mota NDaNascimento SLlorens-Cortes CFournié-Zaluski MCRoques BP Investigation of subsite preferences in aminopeptidase A (EC 3.4.11.7) led to the design of the first highly potent and selective inhibitors of this enzyme. J Med Chem 42:5197-211 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aminopeptidase A
Name:Aminopeptidase A
Synonyms:AP-A | CD_antigen=CD249 | Differentiation antigen gp160 | EAP | Glutamyl aminopeptidase
Type:PROTEIN
Mol. Mass.:109226.47
Organism:Homo sapiens (Human)
Description:ChEMBL_32829
Residue:957
Sequence:
MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHL
PSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVS
ISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPS
SGDGLYLLTMEFAGWLNGSLVGFYRTTYTENGQVKSIVATDHEPTDARKSFPCFDEPNKK
ATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSVPMSTYLVCFAVHQFDSVKRI
SNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIAIPDFGTGAME
NWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYS
KGSSILRMLEDWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTR
QMGYPVLNVNGVKNITQKRFLLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSE
KEGITLNSSNPSGNAFLKINPDHIGFYRVNYEVATWDSIATALSLNHKTFSSADRASLID
DAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVTYIISMFEDDKELYPMIEEYF
QGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPV
NLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFN
TELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50083384
n/a
NameBDBM50083384
Synonyms:1-{[1-(1,2-Dicarboxy-ethylcarbamoyl)-2-methyl-butylcarbamoyl]-mercapto-methyl}-3-sulfo-propyl-ammonium | CHEMBL345941
TypeSmall organic molecule
Emp. Form.C15H27N3O9S2
Mol. Mass.457.52
SMILESCC[C@@H](C)[C@H](NC(=O)[C@H](S)[C@@H]([NH3+])CCS([O-])(=O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: