Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50086884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_160747
Ki 1±n/a nM
Citation Fairlie DPTyndall JDReid RCWong AKAbbenante GScanlon MJMarch DRBergman DAChai CLBurkett BA Conformational selection of inhibitors and substrates by proteolytic enzymes: implications for drug design and polypeptide processing. J Med Chem 43:1271-81 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50086884
n/a
NameBDBM50086884
Synonyms:(R)-N*4*-Hydroxy-2-isobutyl-N*1*-((S)-9-oxo-1,8-diaza-tricyclo[10.6.1.0*13,18*]nonadeca-12(19),13(18),14,16-tetraen-10-yl)-succinamide | CHEMBL281795 | N*4*-Hydroxy-2-isobutyl-N*1*-(9-oxo-1,8-diaza-tricyclo[10.6.1.0*13,18*]nonadeca-12(19),13(18),14,16-tetraen-10-yl)-succinamide | N4-HYDROXY-2-ISOBUTYL-N1-(9-OXO-1,8-DIAZA-TRICYCLO[10.6.1.013,18]NONADECA-12(19),13,15,17-TETRAEN-10-YL)-SUCCINAMIDE
TypeSmall organic molecule
Emp. Form.C25H36N4O4
Mol. Mass.456.5777
SMILESCC(C)C[C@H](CC(=O)NO)C(=O)N[C@H]1Cc2cn(CCCCCCNC1=O)c1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: