Reaction Details |
| Report a problem with these data |
Target | Mu-type opioid receptor |
---|
Ligand | BDBM50102710 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_149479 (CHEMBL758070) |
---|
Ki | 7.3±n/a nM |
---|
Citation | Thomas, JB; Atkinson, RN; Rothman, RB; Fix, SE; Mascarella, SW; Vinson, NA; Xu, H; Dersch, CM; Lu, Y; Cantrell, BE; Zimmerman, DM; Carroll, FI Identification of the first trans-(3R,4R)- dimethyl-4-(3-hydroxyphenyl)piperidine derivative to possess highly potent and selective opioid kappa receptor antagonist activity. J Med Chem44:2687-90 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Mu-type opioid receptor |
---|
Name: | Mu-type opioid receptor |
Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 11165.58 |
Organism: | GUINEA PIG |
Description: | P97266 |
Residue: | 98 |
Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
BDBM50102710 |
---|
n/a |
---|
Name | BDBM50102710 |
Synonyms: | 3-(4-Hydroxy-phenyl)-N-{(S)-1-[(3R,4R)-4-(3-hydroxy-phenyl)-3,4-dimethyl-piperidin-1-ylmethyl]-2-methyl-propyl}-propionamide | 3-(4-Hydroxy-phenyl)-N-{1-[4-(3-hydroxy-phenyl)-3,4-dimethyl-piperidin-1-ylmethyl]-2-methyl-propyl}-propionamide | CHEMBL10986 |
Type | Small organic molecule |
Emp. Form. | C27H38N2O3 |
Mol. Mass. | 438.6022 |
SMILES | CC(C)[C@@H](CN1CC[C@](C)([C@@H](C)C1)c1cccc(O)c1)NC(=O)CCc1ccc(O)cc1 |
Structure |
|