Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin II
LigandBDBM50096105
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212563
Ki 20±n/a nM
Citation Pinto DJOrwat MJWang SFevig JMQuan MLAmparo ECacciola JRossi KAAlexander RSSmallwood AMLuettgen JMLiang LAungst BJWright MRKnabb RMWong PCWexler RRLam PY Discovery of 1-[3-(aminomethyl)phenyl]-N-3-fluoro-2'-(methylsulfonyl)-[1,1'-biphenyl]-4-yl]-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide (DPC423), a highly potent, selective, and orally bioavailable inhibitor of blood coagulation factor Xa. J Med Chem 44:566-78 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Trypsin II
Name:Trypsin II
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 212335
Components:This complex has 2 components.
Component 1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Trypsin
Synonyms:Anionic trypsinogen | Serine protease 2 | Trypsin II | Trypsin-2
Type:PROTEIN
Mol. Mass.:26479.43
Organism:Homo sapiens (Human)
Description:ChEMBL_41517
Residue:247
Sequence:
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50096105
n/a
NameBDBM50096105
Synonyms:2-(3-Carbamimidoyl-phenyl)-5-trifluoromethyl-2H-pyrazole-3-carboxylic acid [5-(2-sulfamoyl-phenyl)-pyrimidin-2-yl]-amide | CHEMBL346857
TypeSmall organic molecule
Emp. Form.C22H17F3N8O3S
Mol. Mass.530.482
SMILESNC(=N)c1cccc(c1)-n1nc(cc1C(=O)Nc1ncc(cn1)-c1ccccc1S(N)(=O)=O)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: