Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMalate dehydrogenase cytoplasmic
LigandBDBM50134036
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104019
IC50 225000±n/a nM
Citation Seidler JMcGovern SLDoman TNShoichet BK Identification and prediction of promiscuous aggregating inhibitors among known drugs. J Med Chem 46:4477-86 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Malate dehydrogenase cytoplasmic
Name:Malate dehydrogenase cytoplasmic
Synonyms:Cytosolic malate dehydrogenase | Malate dehydrogenase, cytoplasmic
Type:PROTEIN
Mol. Mass.:36427.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1456624
Residue:334
Sequence:
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDC
ALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYA
KKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKN
VIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKL
SSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV
EGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134036
n/a
NameBDBM50134036
Synonyms:2-(2,3-Dimethyl-phenylamino)-benzoic acid | 2-(2,3-Dimethyl-phenylamino)-benzoic acid(Mefenamic acid) | 2-(2,3-dimethylphenylamino)benzoic acid | CHEMBL686 | CI-473 | CN-35355 | INF-3355 | MEFENAMIC ACID | Ponstel | cid_4044 | mefanamic acid
TypeSmall organic molecule
Emp. Form.C15H15NO2
Mol. Mass.241.2851
SMILESCc1cccc(Nc2ccccc2C(O)=O)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: