Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50216136 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_439881 (CHEMBL890202) |
---|
Ki | >10000±n/a nM |
---|
Citation | Simpson, DS; Katavic, PL; Lozama, A; Harding, WW; Parrish, D; Deschamps, JR; Dersch, CM; Partilla, JS; Rothman, RB; Navarro, H; Prisinzano, TE Synthetic studies of neoclerodane diterpenes from Salvia divinorum: preparation and opioid receptor activity of salvinicin analogues. J Med Chem50:3596-603 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50216136 |
---|
n/a |
---|
Name | BDBM50216136 |
Synonyms: | (2S,4aR,6aR,7R,9S,10aS,10bR)-methyl 9-acetoxy-2-((2R,3S,5S)-2,5-dimethoxy-tetrahydrofuran-3-yl)dodecahydro-6a,10b-dimethyl-4,10-dioxo-2H-naphtho[2,1-c]pyran-7-carboxylic acid methyl ester | CHEMBL226785 |
Type | Small organic molecule |
Emp. Form. | C25H36O10 |
Mol. Mass. | 496.5473 |
SMILES | CO[C@@H]1C[C@H]([C@H](OC)O1)[C@@H]1C[C@@]2(C)[C@@H](CC[C@@]3(C)[C@@H](C[C@H](OC(C)=O)C(=O)[C@H]23)C(=O)OC)C(=O)O1 |
Structure |
|