Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGhrelin receptor
LigandBDBM50222884
Substrate/Competitorn/a
Meas. Tech.ChEMBL_446527
Ki 1.8±n/a nM
Citation Rudolph JEsler WPO'connor SCoish PDWickens PLBrands MBierer DEBloomquist BTBondar GChen LChuang CYClaus THFathi ZFu WKhire URKristie JALiu XGLowe DBMcClure ACMichels MOrtiz AARamsden PDSchoenleber RWShelekhin TEVakalopoulos ATang WWang LYi LGardell SJLivingston JNSweet LJBullock WH Quinazolinone derivatives as orally available ghrelin receptor antagonists for the treatment of diabetes and obesity. J Med Chem 50:5202-16 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ghrelin receptor
Name:Ghrelin receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:41494.35
Organism:Ovis aries
Description:ChEMBL_446527
Residue:366
Sequence:
MWNATRSEELGPNLTLPDLDWDAAPDNDSLTDELPPLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWHYRPWNLGDLLCKLFQ
FVSESCTYASVLTITALSVERYFAICFPLRAKVVITKGRVKLVVLAIWAVAFCSAWPIFM
LVGVEHENGTDPRDTNECRATEFAVRSGLLTIMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRSEVVVGASLRDQNHKQTVKMLAVVVFAFVLCWLPFHVGRYLFSKSFEPGSVEIAQI
SQYCNLVSFVLFYFSAAINPILYNIMSKKYRVAVFKLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50222884
n/a
NameBDBM50222884
Synonyms:6-(4-chlorophenyl)-3-[(-1-ethylpiperidin-3-yl)methyl]-2-(2-methylphenyl)quinazolin-4(3H)-one | CHEMBL243697
TypeSmall organic molecule
Emp. Form.C29H30ClN3O
Mol. Mass.472.021
SMILESCCN1CCCC(Cn2c(nc3ccc(cc3c2=O)-c2ccc(Cl)cc2)-c2ccccc2C)C1 |w:6.6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: