Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 2C |
---|
Ligand | BDBM50222869 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_446533 (CHEMBL896830) |
---|
Ki | >1000±n/a nM |
---|
Citation | Rudolph, J; Esler, WP; O'connor, S; Coish, PD; Wickens, PL; Brands, M; Bierer, DE; Bloomquist, BT; Bondar, G; Chen, L; Chuang, CY; Claus, TH; Fathi, Z; Fu, W; Khire, UR; Kristie, JA; Liu, XG; Lowe, DB; McClure, AC; Michels, M; Ortiz, AA; Ramsden, PD; Schoenleber, RW; Shelekhin, TE; Vakalopoulos, A; Tang, W; Wang, L; Yi, L; Gardell, SJ; Livingston, JN; Sweet, LJ; Bullock, WH Quinazolinone derivatives as orally available ghrelin receptor antagonists for the treatment of diabetes and obesity. J Med Chem50:5202-16 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 2C |
---|
Name: | 5-hydroxytryptamine receptor 2C |
Synonyms: | 5-HT-1C | 5-HT-2C | 5-HT1C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | 5HT2C_HUMAN | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 51836.79 |
Organism: | Homo sapiens (Human) |
Description: | P28335 |
Residue: | 458 |
Sequence: | MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
|
|
|
BDBM50222869 |
---|
n/a |
---|
Name | BDBM50222869 |
Synonyms: | 6-(4-fluorophenoxy)-3-{[(3S)-1-isopropylpiperidin-3-yl]methyl}-2-methylquinazolin-4(3H)-one | CHEMBL243001 |
Type | Small organic molecule |
Emp. Form. | C24H28FN3O2 |
Mol. Mass. | 409.4964 |
SMILES | CC(C)N1CCC[C@H](Cn2c(C)nc3ccc(Oc4ccc(F)cc4)cc3c2=O)C1 |
Structure |
|