| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 1 |
|---|
| Ligand | BDBM50222913 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_450016 (CHEMBL899112) |
|---|
| IC50 | 3300±n/a nM |
|---|
| Citation |  Teng, M; Zhu, J; Johnson, MD; Chen, P; Kornmann, J; Chen, E; Blasina, A; Register, J; Anderes, K; Rogers, C; Deng, Y; Ninkovic, S; Grant, S; Hu, Q; Lundgren, K; Peng, Z; Kania, RS Structure-based design and synthesis of (5-arylamino-2H-pyrazol-3-yl)-biphenyl-2',4'-diols as novel and potent human CHK1 inhibitors. J Med Chem50:5253-6 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 1 |
|---|
| Name: | Cyclin-dependent kinase 1 |
|---|
| Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 34101.08 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P06493 |
|---|
| Residue: | 297 |
|---|
| Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
|---|
| BDBM50222913 |
|---|
| n/a |
|---|
| Name | BDBM50222913 |
|---|
| Synonyms: | 4'-{5-[4-(isopropylamino-methyl)-phenylamino]-2H-pyrazol-3-yl}-biphenyl-2,4-diol | CHEMBL398606 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H26N4O2 |
|---|
| Mol. Mass. | 414.4995 |
|---|
| SMILES | CC(C)NCc1ccc(Nc2cc(n[nH]2)-c2ccc(cc2)-c2ccc(O)cc2O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
