| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin E2 receptor EP2 subtype |
|---|
| Ligand | BDBM50224572 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_458316 (CHEMBL925647) |
|---|
| Ki | 5690±n/a nM |
|---|
| Citation |  Zhao, Z; Araldi, GL; Xiao, Y; Reddy, AP; Liao, Y; Karra, S; Brugger, N; Fischer, D; Palmer, E Synthesis and evaluation of novel pyrazolidinone analogs of PGE2 as EP2 and EP4 receptors agonists. Bioorg Med Chem Lett17:6572-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin E2 receptor EP2 subtype |
|---|
| Name: | Prostaglandin E2 receptor EP2 subtype |
|---|
| Synonyms: | PE2R2_HUMAN | PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostaglandin E2 receptor | Prostaglandin E2 receptor EP4 subtype | Prostanoid EP2 Receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39775.71 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P43116 |
|---|
| Residue: | 358 |
|---|
| Sequence: | MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
|
|
|
|---|
| BDBM50224572 |
|---|
| n/a |
|---|
| Name | BDBM50224572 |
|---|
| Synonyms: | 4-(2-(2-(4-(3-chlorophenyl)-3-hydroxybutyl)-5-oxopyrazolidin-1-yl)ethyl)benzoic acid | CHEMBL249744 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H25ClN2O4 |
|---|
| Mol. Mass. | 416.898 |
|---|
| SMILES | OC(CCN1CCC(=O)N1CCc1ccc(cc1)C(O)=O)Cc1cccc(Cl)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
