Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 12 |
---|
Ligand | BDBM50371579 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_463779 (CHEMBL931130) |
---|
IC50 | 237±n/a nM |
---|
Citation | Douglass, JG; Patel, RI; Yerxa, BR; Shaver, SR; Watson, PS; Bednarski, K; Plourde, R; Redick, CC; Brubaker, K; Jones, AC; Boyer, JL Lipophilic modifications to dinucleoside polyphosphates and nucleotides that confer antagonist properties at the platelet P2Y12 receptor. J Med Chem51:1007-25 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 12 |
---|
Name: | P2Y purinoceptor 12 |
Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
Type: | Enzyme |
Mol. Mass.: | 39458.48 |
Organism: | Homo sapiens (Human) |
Description: | Q9H244 |
Residue: | 342 |
Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
BDBM50371579 |
---|
n/a |
---|
Name | BDBM50371579 |
Synonyms: | CHEMBL1162171 |
Type | Small organic molecule |
Emp. Form. | C26H33N6O8P |
Mol. Mass. | 588.5494 |
SMILES | CCCCCCNC(=O)Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(O)=O)[C@H]2OC(O[C@@H]12)\C=C\c1ccccc1 |r| |
Structure |
|