| Reaction Details |
|---|
 | Report a problem with these data |
| Target | P2Y purinoceptor 12 |
|---|
| Ligand | BDBM50371571 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_463779 (CHEMBL931130) |
|---|
| IC50 | 7590±n/a nM |
|---|
| Citation |  Douglass, JG; Patel, RI; Yerxa, BR; Shaver, SR; Watson, PS; Bednarski, K; Plourde, R; Redick, CC; Brubaker, K; Jones, AC; Boyer, JL Lipophilic modifications to dinucleoside polyphosphates and nucleotides that confer antagonist properties at the platelet P2Y12 receptor. J Med Chem51:1007-25 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| P2Y purinoceptor 12 |
|---|
| Name: | P2Y purinoceptor 12 |
|---|
| Synonyms: | ADP-glucose receptor | ADPG-R | HORK3 | P2RY12 | P2T(AC) | P2Y purinoceptor 12 | P2Y(AC) | P2Y(ADP) | P2Y(cyc) | P2Y12 | P2Y12 platelet ADP receptor | P2Y12_HUMAN | Purinergic receptor P2Y12 | SP1999 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39458.48 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9H244 |
|---|
| Residue: | 342 |
|---|
| Sequence: | MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFI
IFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITI
DRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKS
EFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFI
IIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFF
LCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
|
|
|
|---|
| BDBM50371571 |
|---|
| n/a |
|---|
| Name | BDBM50371571 |
|---|
| Synonyms: | CHEMBL1162181 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H40N6O25P4 |
|---|
| Mol. Mass. | 1056.6016 |
|---|
| SMILES | CNc1ccccc1C(=O)O[C@@H]1[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OC[C@@H]2O[C@@H]([C@@H](OC(=O)c3ccccc3NC)[C@H]2O)n2ccc(=O)[nH]c2=O)O[C@H]([C@@H]1O)n1ccc(=O)[nH]c1=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
